Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens neuropeptide Y (NPY) (NM_000905). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P01303 |
| Entry Name | NPY_HUMAN |
| Gene Names | NPY |
| Alternative Gene Names | |
| Alternative Protein Names | Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 97 |
| Molecular Weight(Da) | 10851 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
Background
| Function | FUNCTION: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Pathway | |
| Protein Families | NPY family |
| Tissue Specificity | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |